ZNF322A Antibody - C-terminal regio : FITC (ARP39605_P050-FITC)

Zinc finger protein 322

HCG12, ZNF388, ZNF489, ZNF322A

79692

Q6U7Q0

NP_078915

Human, Mouse, Rat, Cow, Dog, Goat, Horse, Pig, Rabbit

The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF322A

ZNF322 contains four exons and spans 23.2kb in chromosome 6p22.1 region, and transcribes a 2.7kb mRNA that encodes a protein with 402 amino acid residues.Through northern blot analysis, ZNF322 was shown to be expressed in every human tissue examined at adult stage and during embryonic developmental stages from 80 days to 24 weeks. When ZNF322 was overexpressed in COS-7 cells, ZNF322-EGFP fusion protein is detected in the nucleus and cytoplasm. Reporter gene assays show that ZNF322 is a transcriptional activator. Furthermore, overexpression of ZNF322 in COS-7 cells activates the transcriptional activity of SRE and AP-1. Together, these results suggest that ZNF322 is a member of the zinc-finger transcription factor family and may act as a positive regulator in gene transcription mediated by the MAPK signaling pathways.

APP

FITC: Fluorescein Isothiocyanate

Polyclonal Antibody

IHC, WB

Affinity Purified

0.5 mg/ml

Cow: 85%; Dog: 100%; Goat: 92%; Horse: 100%; Human: 100%; Mouse: 79%; Pig: 92%; Rabbit: 92%; Rat: 79%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

47kDa

Li, Y., (2004) Biochem. Biophys. Res. Commun. 325 (4), 1383-1392

Wet Ice

402

ZNF322

ZNF322

Rabbit

Zinc finger protein 322

NM_024639

YTVCDKSFHQSSALLQHQTVHIGEKPFVCNVSEKGLELSPPHASEASQMS