ZNF331 Antilichaam - N-terminal regio : HRP (ARP35957_P050-HRP)

Zinc finger protein 331

RITA, ZNF361, ZNF463

55422

Q9NQX6

NP_061025

Human

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF331

ZNF331 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 12 C2H2-type zinc fingers and 1 KRAB domain. ZNF331 may be involved in transcriptional regulation. It may play a role in spermatogenesis. Zinc finger proteins have been shown to interact with nucleic acids and to have diverse functions. The zinc finger domain is a conserved amino acid sequence motif containing 2 specifically positioned cysteines and 2 histidines that are involved in coordinating zinc. Kruppel-related proteins form one family of zinc finger proteins. See ZFP93 (MIM 604749) for additional information on zinc finger proteins.[supplied by OMIM].

ZNF408; ZNF212; FHL2; UBC; C8orf33; SURF2; PTK2; MAPK6; NR4A1; Trim28

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Human: 93%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

54kDa

Meiboom, M., (2004) Anim. Genet. 35 (3), 262-263

Wet Ice

463

ZNF331

ZNF331

Rabbit

Zinc finger protein 331

NM_018555

YENKSLPTEKNIHEIRASKRNSDRRSKSLGRNWICEGTLERPQRSRGRYV