ZO-1 Konijn pAb (APR17504N)

This gene encodes a protein located on a cytoplasmic membrane surface of intercellular tight junctions. The encoded protein may be involved in signal transduction at cell-cell junctions. Alternative splicing of this gene results in multiple transcript variants.

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ZO-1 Rabbit pAb (APR17504N) .

TJP1; ZO-1

7082

Q07157

Cell junction, Cell membrane, Cytoplasmic side, Peripheral membrane protein, gap junction, tight junction

WB (Homo sapiens, Mus musculus, Rattus norvegicus, Gallus gallus, Sus scrofa) IF (Mus musculus, Rattus norvegicus, Homo sapiens)

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Liquid

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Calculated MW: 186kDa/195kDa Observed MW: 250kDa

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=7082

https://www.uniprot.org/uniprot/Q07157

PKYQINNISTVPKAIPVSPSAVEEDEDEDGHTVVATARGIFNSNGGVLSSIETGVSIIIPQGAIPEGVEQEIYFKVCRDNSILPPLDKEKGETLLSPLVMC