ZSCAN2 Antilichaam - N-terminalgebied: FITC (ARP40048 P050-FITC)

Zinc finger and SCAN domain containing 2

ZFP29, ZNF854

54993

Q7Z7L9

NP_870992

Human, Mouse, Rat, Cow, Dog, Pig

The immunogen is a synthetic peptide directed towards the N terminal region of human ZSCAN2

ZSCAN2 contains several copies of zinc finger motif, which is commonly found in transcriptional regulatory proteins. Studies in mice show that ZSCAN2 is expressed during embryonic development, and specifically in the testis in adult mice, suggesting that it may play a role in regulating genes in germ cells.The protein encoded by this gene contains several copies of zinc finger motif, which is commonly found in transcriptional regulatory proteins. Studies in mice show that this gene is expressed during embryonic development, and specifically in the testis in adult mice, suggesting that it may play a role in regulating genes in germ cells. Alternative splicing of this gene results in several transcript variants encoding different isoforms.The protein encoded by this gene contains several copies of zinc finger motif, which is commonly found in transcriptional regulatory proteins. Studies in mice show that this gene is expressed during embryonic development, and specifically in the testis in adult mice, suggesting that it may play a role in regulating genes in germ cells. Alternative splicing of this gene results in several transcript variants encoding different isoforms.

HDAC8; UBC

FITC: Fluorescein Isothiocyanate

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 86%; Dog: 100%; Human: 100%; Mouse: 100%; Pig: 86%; Rat: 100%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

67kDa

Denny, P. (1991) Gene 106 (2), 221-227

Wet Ice

613

ZSCAN2

ZSCAN2

Rabbit

Zinc finger and SCAN domain-containing protein 2

NM_181877

TTMILEDDSWVQEAVLQEDGPESEPFPQSAGKGGPQEEVTRGPQGALGRL