Anti-Preseniline 2 loop regio Antilichaam

Autosomal dominant mutations in presenilin 2 are the second major cause of early-onset familial Alzheimer's disease. Presenilin 2 is a multi-transmembrane protein which undergoes endoprotelysis to form an N-terminal fragment of about 29 kDa and C-terminal fragment of about 22 kDa. Presenilin 2 forms the catalytic core of the gamma-secretase complex which cleaves type 1 transmembrane proteins including the amyloid precursor protein to generate the C-terminus of the amyloid beta peptide.

Our Anti-Presenilin 2 loop region rabbit polyclonal primary antibody detects human and mouse Presenilin 2 loop region , and is igg. It is validated for use in ICC, WB.

Our Anti-Presenilin 2 loop region rabbit polyclonal primary antibody detects human and mouse Presenilin 2 loop region, and is IgG. It is validated for use in ICC, WB.

AD3LP, AD5, E5-1, STM-2

P49810

Human and Mouse

A synthetic peptide (KLDPSSQGALQLPYDPEMEEDSYDSFGEP-C) corresponding to human PS1 [306-334] in the loop region conjugated via additional C-terminal Cys to Diphtheria toxoid.

Presenilin 2 loop region

Unconjugated

ICC, WB

IgG

Lyophilized from PBS, pH 7.4. Contains no preservative.

22 kDa, 45 kDa (See application details.)

For research use only.

25°C (ambient)

Spin vial briefly before opening. Reconstitute in 500 μL sterile-filtered 1X PBS, pH 7.2-7.6. Centrifuge to remove any insoluble material. Short term storage at 2-8°C for one week. At -20°C as an undiluted liquid for up to 12 months.

Protein G purified IgG

0.7361111111111112

0.1111111111111111

Confirmed by Western blot using mouse and human brain and knock down of presenilin 2 in vitro using siRNA see ref 6 below. Not reactive with presenilin 1.

Rabbit

Lyophilized

IgG

Human