APOBEC3B Antilichaam - N-terminalgebied: HRP (ARP46114_P050-HRP)

Apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3B

A3B, ARP4, ARCD3, PHRBNL, APOBEC1L, bK150C2.2, DJ742C19.2

9582

Q9UH17

NP_004891

Human, Rat, Cow, Horse, Pig, Rabbit, Zebrafish

The immunogen is a synthetic peptide directed towards the N terminal region of human APOBEC3B

APOBEC3B is a member of the cytidine deaminase family. It is thought that these proteins may be RNA editing enzymes and have roles in growth or cell cycle control.This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. It is thought that the proteins may be RNA editing enzymes and have roles in growth or cell cycle control.

UBC; EED

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 82%; Horse: 91%; Human: 100%; Pig: 92%; Rabbit: 82%; Rat: 91%; Zebrafish: 90%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

46kDa

Bogerd, H.P., (2006) (er) Nucleic Acids Res. 34 (1), 89-95

Wet Ice

382

APOBEC3B

APOBEC3B

Rabbit

Probable DNA dC->dU-editing enzyme APOBEC-3B

NM_004900

NQLPAYKCFQITWFVSWTPCPDCVAKLAEFLSEHPNVTLTISAARLYYYW