ATP2B3 Antilichaam - N-terminalgebied: HRP (ARP44390_P050-HRP)

ATPase, Ca++ transporting, plasma membrane 3

CLA2, OPCA, PMCA3, SCAX1, CFAP39, PMCA3a

492

Q16720

NP_001001344

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit

The immunogen is a synthetic peptide directed towards the N terminal region of human ATP2B3

ATP2B3 gene belongs to the family of P-type primary ion transport ATPases characterized by the formation of an aspartyl phosphate intermediate during the reaction cycle. These enzymes remove bivalent calcium ions from eukaryotic cells against very large concentration gradients and play a critical role in intracellular calcium homeostasis. The mammalian plasma membrane calcium ATPase isoforms are encoded by at least four separate genes and the diversity of these enzymes is further increased by alternative splicing of transcripts. The expression of different isoforms and splice variants is regulated in a developmental, tissue- and cell type-specific manner, suggesting that these pumps are functionally adapted to the physiological needs of particular cells and tissues. ATP2B3 is the plasma membrane calcium ATPase isoform 3.The protein encoded by this gene belongs to the family of P-type primary ion transport ATPases characterized by the formation of an aspartyl phosphate intermediate during the reaction cycle. These enzymes remove bivalent calcium ions from eukaryotic cells against very large concentration gradients and play a critical role in intracellular calcium homeostasis. The mammalian plasma membrane calcium ATPase isoforms are encoded by at least four separate genes and the diversity of these enzymes is further increased by alternative splicing of transcripts. The expression of different isoforms and splice variants is regulated in a developmental, tissue- and cell type-specific manner, suggesting that these pumps are functionally adapted to the physiological needs of particular cells and tissues. This gene encodes the plasma membrane calcium ATPase isoform 3. Alternatively spliced transcript variants encoding different isoforms have been identified.

LGR4; PARK2; UBC; TERF2

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 100%; Dog: 100%; Guinea Pig: 79%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 86%; Rat: 100%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

134kDa

Martin, R., (2007) Bone 40 (5), 1203-1208

Wet Ice

1220

ATP2B3

ATP2B3

Rabbit

Plasma membrane calcium-transporting ATPase 3

NM_001001344

GDMANSSIEFHPKPQQQRDVPQAGGFGCTLAELRTLMELRGAEALQKIEE