BiP/GR78 Rabbit pAb (APR17363N)

The protein encoded by this gene is a member of the heat shock protein 70 (HSP70) family. It is localized in the lumen of the endoplasmic reticulum (ER), and is involved in the folding and assembly of proteins in the ER. As this protein interacts with many ER proteins, it may play a key role in monitoring protein transport through the cell.

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality BiP/GRP78 Rabbit pAb (APR17362N) .

HSPA5; BIP; GRP78; HEL-S-89n; MIF2

3309

P11021

Cytoplasm, Endoplasmic reticulum lumen, Melanosome

WB (RAW264.7, Rat spinal cord, Mouse marrow, Homo sapiens, Mus musculus, Panax notoginseng (Burk.) F. H. Chen , Rattus norvegicus) IF (Homo sapiens, Panax notoginseng (Burk.) F. H. Chen) IHC (Rattus norvegicus)

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Liquid

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Calculated MW: 72kDa Observed MW: 78KDa

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3309

https://www.uniprot.org/uniprot/P11021

EEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSSEDKETMEKAVEEKIEWLESHQDADIEDFKAKKKELEEIVQPIISKLYGSAGPPPTGEEDTAE