Btrc Antilichaam - C-terminal regio : HRP (ARP42160 P050-HRP)

Beta-transducin repeat containing protein

Sl, HOS, FWD1, Fbw1, Fbw1a, Slimb, b-TrCP, beta-T, Beta-Tr, beta-TrCP, Beta-Trcp1, SCF b-TRCP, E3RSIkappaB, E3RS-IkappaB

12234

Q3ULA2

NP_001032847

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit

Btrc is a substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. It recognizes and binds to phosphorylated target proteins. SCF (BTRC) mediates the ubiquitination of CTNNB1 and participates in Wnt signaling. SCF (BTRC) mediates the ubiquitination of NFKBIA, NFKBIB and NFKBIE; the degradation frees the associated NFKB1 to translocate into the nucleus and to activate transcription. Ubiquitination of NFKBIA occurs at 'Lys-21' and 'Lys-22'. SCF (BTRC) mediates the ubiquitination of phosphorylated NFKB1/nuclear factor NF-kappa-B p105 subunit, ATF4, SMAD3, SMAD4, CDC25A, DLG1, FBXO5 and probably NFKB2. SCF (BTRC) mediates the ubiquitination of phosphorylated SNAI1.

ZRANB1; Tpx2; Taz; Per2; Cul1; Skp1a; Reg1; Stat1; Nfe2l2; Per1; Htt; Cops2; Ikbkb; Nkx3-2; Cdc25b; Nfkbia; Gli2

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 86%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

69kDa

Wet Ice

605

BTRC

Btrc

Rabbit

F-box/WD repeat-containing protein 1A

NM_001037758

LVEHSGRVFRLQFDEFQIVSSSHDDTILIWDFLNDPAAHAEPPRSPSRTY