C21orf66 Antilichaam - C-terminaal gebied : FITC (ARP47636_P050-FITC)

GC-rich sequence DNA-binding factor 1

GCFC, BM020, GCFC1, FSAP105, C21orf66

94104

Q9Y5B6

NP_057715

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit

The immunogen is a synthetic peptide directed towards the C terminal region of human C21orf66

Similarity to a transcriptional repressor suggests that C21orf66 is involved in the regulation of transcription. Alternative splicing of this gene results in three transcript variants encoding different isoforms. Additional transcript variants have been described, but their full-length sequences have not been determined. Similarity to a transcriptional repressor suggests that this gene's protein product is involved in the regulation of transcription. Alternative splicing of this gene results in three transcript variants encoding different isoforms. Additional transcript variants have been described, but their full-length sequences have not been determined.

UBC; BMI1; rev; HDAC11; SUMO2; Prpf8; Snw1; TERF2

FITC: Fluorescein Isothiocyanate

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

105kDa

Olsen, J.V., (2006) Cell 127 (3), 635-648

Wet Ice

917

PAXBP1

PAXBP1

Rabbit

GC-rich sequence DNA-binding factor 1

NM_016631

IGCSDVEKRNARENIKQIVKLLASVRALDHAMSVASDHNVKEFKSLIEGK