C21orf66 Antilichaam - N-terminaal gebied : HRP (ARP47635_P050-HRP)

GC-rich sequence DNA-binding factor 1

GCFC, BM020, GCFC1, FSAP105, C21orf66

94104

Q9Y5B6

NP_037461

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish

The immunogen is a synthetic peptide directed towards the N terminal region of human C21orf66

Similarity to a transcriptional repressor suggests that C21orf66 is involved in the regulation of transcription. Alternative splicing of this gene results in three transcript variants encoding different isoforms. Additional transcript variants have been described, but their full-length sequences have not been determined. Similarity to a transcriptional repressor suggests that this gene's protein product is involved in the regulation of transcription. Alternative splicing of this gene results in three transcript variants encoding different isoforms. Additional transcript variants have been described, but their full-length sequences have not been determined.

UBC; BMI1; rev; HDAC11; SUMO2; Prpf8; Snw1; TERF2

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

93kDa

Olsen, J.V., (2006) Cell 127 (3), 635-648

Wet Ice

815

PAXBP1

PAXBP1

Rabbit

GC-rich sequence DNA-binding factor 1

NM_013329

PGEIPDAAFIHAARKKRQMARELGDFTPHDNEPGKGRLVREDENDASDDE