CERKL Antilichaam - C-terminal regio : HRP (ARP59827 P050-HRP)

Ceramide kinase-like

RP26

375298

Q49MI3

NP_001025484

Human, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish

The immunogen is a synthetic peptide directed towards the C terminal region of human CERKL

This gene was initially identified as a locus (RP26) associated with an autosomal recessive form of retinitis pigmentosa (arRP) disease. This gene encodes a protein with ceramide kinase-like domains, however, the protein does not phosphorylate ceramide and its target substrate is currently unknown. This protein may be a negative regulator of apoptosis in photoreceptor cells. Mutations in this gene cause a form of retinitis pigmentosa characterized by autosomal recessive cone and rod dystrophy (arCRD) . Alternative splicing of this gene results in multiple transcript variants encoding different isoforms and non-coding transcripts.

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Dog: 90%; Guinea Pig: 79%; Horse: 79%; Human: 100%; Mouse: 79%; Rabbit: 81%; Rat: 79%; Yeast: 89%; Zebrafish: 79%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

51kDa

Wet Ice

463

CERKL

CERKL

Rabbit

Ceramide kinase-like protein

NM_001030313

ASVKNQFNFPFVETYTVEEVKVHPRNNTGGYNPEEEEDETASENCFPWNV