CHRNA9 Antilichaam - N-terminalgebied: HRP (ARP35266 P050-HRP)

Cholinergic receptor, nicotinic, alpha 9 (neuronal)

NACHRA9, HSA243342

55584

Q9UGM1

NP_060051.2

Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit

The immunogen for Anti-CHRNA9 antibody is: synthetic peptide directed towards the N-terminal region of Human ACHA9

This gene is a member of the ligand-gated ionic channel family and nicotinic acetylcholine receptor gene superfamily. It encodes a plasma membrane protein that forms homo- or hetero-oligomeric divalent cation channels. This protein is involved in cochlea hair cell development and is also expressed in the outer hair cells (OHCs) of the adult cochlea.

UBC; Rapsn

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity purified

0.5 mg/ml

Cow: 86%; Dog: 93%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 86%; Rabbit: 93%; Rat: 86%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

52 kDa

Wet Ice

479

CHRNA9

CHRNA9

Rabbit

Neuronal acetylcholine receptor subunit alpha-9

NWSHSCISFCWIYFAASRLRAAETADGKYAQKLFNDLFEDYSNALRPVED