CYP21A2 Antilichaam - C-terminaal gebied: Biotine (ARP60144 P050-Biotine)

Cytochrome P450, family 21, subfamily A, polypeptide 2

CAH1, CPS1, CA21H, CYP21, CYP21B, P450c21B

1589

Q16874

NP_000491

Human, Cow, Dog, Guinea Pig, Pig, Sheep

The immunogen is a synthetic peptide directed towards the C terminal region of human CYP21A2

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and hydroxylates steroids at the 21 position. Its activity is required for the synthesis of steroid hormones including cortisol and aldosterone. Mutations in this gene cause congenital adrenal hyperplasia. A related pseudogene is located near this gene; gene conversion events involving the functional gene and the pseudogene are thought to account for many cases of steroid 21-hydroxylase deficiency. Two transcript variants encoding different isoforms have been found for this gene.

Biotin

Polyclonal Antibody

IHC, WB

Affinity Purified

0.5 mg/ml

Cow: 92%; Dog: 92%; Guinea Pig: 80%; Human: 100%; Pig: 92%; Sheep: 92%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

56kDa

Wet Ice

495

CYP21A2

CYP21A2

Rabbit

Cytochrome P450 21-hydroxylase EMBL AAB67982.1

NM_000500

IQQRLQEELDHELGPGASSSRVPYKDRARLPLLNATIAEVLRLRPVVPLA