CYP2A13 Antilichaam - C-terminaal gebied: HRP (ARP41803 T100-HRP)

Cytochrome P450, family 2, subfamily A, polypeptide 13

CPAD, CYP2A, CYPIIA13

1553

Q16696

NP_000757

Human, Mouse, Rat, Cow, Guinea Pig, Horse, Sheep

The immunogen is a synthetic peptide directed towards the C terminal region of human CYP2A13

CYP2A13 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum. Although its endogenous substrate has not been determined, it is known to metabolize 4- (methylnitrosamino) -1- (3-pyridyl) -1-butanone, a major nitrosamine specific to tobacco.This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum. Although its endogenous substrate has not been determined, it is known to metabolize 4- (methylnitrosamino) -1- (3-pyridyl) -1-butanone, a major nitrosamine specific to tobacco. This gene is part of a large cluster of cytochrome P450 genes from the CYP2A, CYP2B and CYP2F subfamilies on chromosome 19q.

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

0.5 mg/ml

Cow: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 85%; Rat: 91%; Sheep: 93%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

54kDa

He, X.Y., (2004) Drug Metab. Dispos. 32 (12), 1516-1521

Wet Ice

494

CYP2A13

CYP2A13

Rabbit

Cytochrome P450 2A13

NM_000766

DPRFFSNPRDFNPQHFLDKKGQFKKSDAFVPFSIGKRYCFGEGLARMELF