Fzr1 Antilichaam - N-terminaal gebied : HRP (ARP51278_P050-HRP)

Fizzy/cell division cycle 20 related 1 (Drosophila)

Fy, FZR, Fyr, Cdh1, FZR2, HCDH, HCDH1, AW108046

56371

Q9R1K5

NP_062731

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Zebrafish

The immunogen is a synthetic peptide corresponding to a region of Mouse

Fzr1 is the key regulator of ligase activity of the anaphase promoting complex/cyclosome (APC/C), which confers substrate specificity upon the complex. Fzr1 associates with the APC/C in late mitosis, in replacement of CDC20, and activates the APC/C during anaphase and telophase. The APC/C remains active in degrading substrates to ensure that positive regulators of the cell cycle do not accumulate prematurely. At the G1/S transition FZR1 is phosphorylated, leading to its dissociation from the APC/C. Following DNA damage, it is required for the G2 DNA damage checkpoint: its dephosphorylation and reassociation with the APC/C leads to the ubiquitination of PLK1, preventing entry into mitosis.

Arhgap35; Rrm2; Ccnb1; Cdc27; Sirt2; Smurf1; Skil; Ube2c; Csf3r

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 100%; Rat: 93%; Zebrafish: 92%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

55kDa

Wet Ice

493

FZR1

Fzr1

Rabbit

Fizzy-related protein homolog

NM_019757

RQIIIQNENTVPCVSEMRRTLTPANSPVSSPSKHGDRFIPSRAGANWSVN