Gfm1 Antilichaam - C-terminalgebied: HRP (ARP60908 P050-HRP)

G elongation factor, mitochondrial 1

Gfm, AW545374, D3Wsu133, D3Wsu133e

28030

Q8K0D5

NP_613057

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit

Gfm1 is a mitochondrial GTPase that catalyzes the GTP-dependent ribosomal translocation step during translation elongation. During this step, the ribosome changes from the pre-translocational (PRE) to the post-translocational (POST) state as the newly formed A-site-bound peptidyl-tRNA and P-site-bound deacylated tRNA move to the P and E sites, respectively. Gfm1 catalyzes the coordinated movement of the two tRNA molecules, the mRNA and conformational changes in the ribosome. Gfm1 does not mediate the disassembly of ribosomes from messenger RNA at the termination of mitochondrial protein biosynthesis.

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

83kDa

Wet Ice

751

GFM1

Gfm1

Rabbit

Elongation factor G, mitochondrial

NM_138591

ELRSCTEGKGEYTMEYCRYQPCSPSTQEELINKYLEATGQLPVKKGKAKN