GNAT1 Antilichaam - N-terminalgebied: HRP (ARP59912 P050-HRP)

Guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 1

GBT1, GNATR, CSNB1G, CSNBAD3

2779

P11488

NP_653082.1

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep, Zebrafish

The immunogen is a synthetic peptide directed towards the N-terminal region of Human GNAT1

Transducin is a 3-subunit guanine nucleotide-binding protein (G protein) which stimulates the coupling of rhodopsin and cGMP-phoshodiesterase during visual impulses. The transducin alpha subunits in rods and cones are encoded by separate genes. This gene encodes the alpha subunit in rods. This gene is also expressed in other cells, and has been implicated in bitter taste transduction in rat taste cells. Mutations in this gene result in autosomal dominant congenital stationary night blindness. Multiple alternatively spliced variants, encoding the same protein, have been identified.

UBC; Haus1; RGS9; RGS16; F2R

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity purified

0.5 mg/ml

Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 77%; Rat: 100%; Sheep: 77%; Zebrafish: 85%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

38 kDa

Wet Ice

350

GNAT1

GNAT1

Rabbit

Guanine nucleotide-binding protein G (t) subunit alpha-1

YSLEECLEFIAIIYGNTLQSILAIVRAMTTLNIQYGDSARQDDARKLMHM