Geitenanti-REP2 Polyklonaal antilichaam

REP2 is the component A2 of the RAB geranylgeranyl transferase holoenzyme. REP2 binds most of unprenylated Rab GTPases and then presents them to the catalytic Rab GGTase subunit for the geranylgeranyl transfer reaction and may substitute REP1.

9007-83-4

Detects endogenous REP2 by Western blot. This Ab is specific for REP2, it does not cross-react with REP1.

CHmL, CHM like, rab escort protein 2 antibody.

Choroideremia (Rab escort protein 2)

100 µL

ENSG00000203668

ENSG00000203668

Human

Human, mouse, rat, bovine, canine, chicken/avian, donkey, feline, goat, guinea pig, hamster, horse, porcine, rabbit, sheep, simian, other

Purified recombinant peptide derived from within residues 617 aa - stop at the C-terminus of human REP2 produced in E. coli.

Purified recombinant peptide derived from within residues 617 aa - stop at the C-terminus of human REP2 produced in E. coli.

Recombinant protein

Anti-REP2

Unconjugated

Primary

IIFDGDDKQPEAPGTNNVVMAKLESSEESKNLESPEKHLQN

WB

Epitope affinity purified

3 mg/mL

WB:1:500-1:5,000

Polyclonal antibody supplied as a 100 µl (3 mg/mL) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.

PBS, 20% glycerol and 0.05% sodium azide

For continuous use, store at 2-8 deg;C for one-two days. For extended storage, store in -20 deg;C freezer. Working dilution samples should be discarded if not used within 12 hours.