GUCA1A Antilichaam - N-terminalgebied: FITC (ARP54309 P050-FITC)

Guanylate cyclase activator 1A (retina)

COD3, GCAP, GUCA, GCAP1, GUCA1, CORD14, C6orf131

2978

P43080

NP_000400

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit

The immunogen is a synthetic peptide directed towards the N terminal region of human GUCA1A

GUCA1A (GCAP1) plays a role in the recovery of retinal photoreceptors from photobleaching. In the recovery phase, the phototransduction messeneger cGMP is replenished by retinal guanylyl cyclase-1 (GC1) . GC1 is activated by decreasing Ca (2+) concentrations following photobleaching. The protein mediates the sensitivity of GC1 to Ca (2+) concentrations. GCAP1 promotes activity of GC1 at low Ca (2+) concentrations and inhibits GC1 activity at high Ca (2+) concentrations. Mutations in this gene cause autosomal dominant cone dystrophy (COD3) ; a disease characterized by reduced visual acuity associated with progressive loss of color vision. Mutations in this gene prohibit the inactivation of RetGC1 at high Ca (2+) concentrations; causing the constitutive activation of RetGC1 and, presumably, increased cell death. This gene is expressed in retina and spermatagonia.

GUCY2D

FITC: Fluorescein Isothiocyanate

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 93%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 93%; Rat: 100%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

23kDa

Michaelides, M., (2005) Ophthalmology 112 (8), 1442-1447

Wet Ice

201

GUCA1A

GUCA1A

Rabbit

Guanylyl cyclase-activating protein 1

NM_000409

LYEFRQFFGLKNLSPSASQYVEQMFETFDFNKDGYIDFMEYVAALSLVLK