HACE1 Antilichaam - N-terminalgebied: HRP (ARP43276_P050-HRP)

HECT domain and ankyrin repeat containing E3 ubiquitin protein ligase 1

SPPRS

57531

Q8IYU2-4

NP_065822

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish

The immunogen is a synthetic peptide directed towards the N-terminal region of Human HACE1

HACE1 is a E3 ubiquitin-protein ligase involved in Golgi membrane fusion and regulation of small GTPases. It acts as a regulator of Golgi membrane dynamics during the cell cycle: recruited to Golgi membrane by Rab proteins and regulates postmitotic Golgi membrane fusion. It acts by mediating ubiquitination during mitotic Golgi disassembly, ubiquitination serving as a signal for Golgi reassembly later, after cell division. HACE1 specifically interacts with GTP-bound RAC1, mediating ubiquitination and subsequent degradation of active RAC1, thereby playing a role in host defense against pathogens. It may also act as a transcription regulator via its interaction with RARB.

UBE2L3; UBC; OPTN; Unc45b; Flna; Actn1; Cald1; Lima1; Actn4; Tpm3; Tmod3; Coro1c; Vim; Vcl; Tubb5; Tubb4a; Tpm2; Tpm1; Tcp1; Plec; Sqstm1; Npm1; Myh9; Marcks; Hspa9; Hsp90ab1; Hspd1; Hspa8; Fhl1; Csrp1; Cnn2; Cct8; Serpinh1; Capzb; Capza2; Capza1; Actg1

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

76kDa

Wet Ice

694

HACE1

HACE1

Rabbit

E3 ubiquitin-protein ligase HACE1

NM_020771

RARTVELPEDNETAVYTLMPMVMADQHRSVSELLSNSKFDVNYAFGRVKR