Hand2 Antilichaam - C-terminalgebied: FITC (ARP30571 P050-FITC)

Heart and neural crest derivatives expressed transcript 2

Hed, Th2, dHA, Ehan, Thin, bHLHa, dHAND, Ehand2, Thing2, bHLHa26, AI225906, AI661148

15111

Q61039

NP_034532

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish

The immunogen is a synthetic peptide corresponding to a region of Mouse

Hand2 is essential for cardiac morphogenesis, particularly for the formation of the right ventricle and of the aortic arch arteries. It is required for vascular development and regulation of angiogenesis, possibly through a VEGF signaling pathway. It plays also an important role in limb development, particularly in the establishment of anterior-posterior polarization, acting as an upstream regulator of sonic hedgehog (SHH) induction in the limb bud. Hand2 is involved in the development of branchial arches, which give rise to unique structures in the head and neck.

Nkx2-5; Hand1; Tcf3; Tcf4; Tcf12; Hoxd13; Twist1

FITC: Fluorescein Isothiocyanate

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 87%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

24kDa

Wet Ice

217

HAND2

Hand2

Rabbit

Heart- and neural crest derivatives-expressed protein 2

NM_010402

DQNGEAEAFKAEIKKTDVKEEKRKKELNEILKSTVSSNDKKTKGRTGWPQ