HAVCR2 Antilichaam - N-terminalgebied: FITC (ARP45550 P050-FITC)

Hepatitis A virus cellular receptor 2

TIM3, CD366, KIM-3, SPTCL, TIMD3, Tim-3, TIMD-3, HAVcr-2

84868

Q8TDQ0

NP_116171

Human, Dog

The immunogen is a synthetic peptide directed towards the N terminal region of human HAVCR2

HAVCR2 regulates macrophage activation. HAVCR2 inhibits T-helper type 1 lymphocyte (Th1) -mediated auto- and alloimmune responses and promotes immunological tolerance. HAVCR2 may be also involved in T-cell homing. HAVCR2 is the receptor for LGALS9.CD4 (MIM 186940) -positive T helper lymphocytes can be divided into types 1 (Th1) and 2 (Th2) on the basis of their cytokine secretion patterns. Th1 cells and their associated cytokines are involved in cell-mediated immunity to intracellular pathogens and delayed-type hypersensitivity reactions, whereas Th2 cells are involved in the control of extracellular helminthic infections and the promotion of atopic and allergic diseases. The 2 types of cells also cross-regulate the functions of the other. TIM3 is a Th1-specific cell surface protein that regulates macrophage activation and enhances the severity of experimental autoimmune encephalomyelitis in mice.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

BAG6; LCK; APP; HAVCR2

FITC: Fluorescein Isothiocyanate

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Dog: 79%; Human: 100%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

33kDa

Nuchnoi, P., Ann. Hum. Genet. 72 (PT 3), 327-336 (2008)

Wet Ice

301

HAVCR2

HAVCR2

Rabbit

Hepatitis A virus cellular receptor 2

NM_032782

MFSHLPFDCVLLLLLLLLTRSSEVEYRAEVGQNAYLPCFYTPAAPGNLVP