IGLL1 Antilichaam - N-terminalgebied: HRP (ARP42547_T100-HRP)

Immunoglobulin lambda-like polypeptide 1

IGO, 14.1, AGM2, IGL1, IGL5, IGLL, IGVPB, CD179b, VPREB2, IGLJ14.1

3543

P15814

NP_064455

Human

The immunogen is a synthetic peptide directed towards the N terminal region of human IGLL1

The preB cell receptor is found on the surface of proB and preB cells, where it is involved in transduction of signals for cellular proliferation, differentiation from the proB cell to the preB cell stage, allelic exclusion at the Ig heavy chain gene locus, and promotion of Ig light chain gene rearrangements. The preB cell receptor is composed of a membrane-bound Ig mu heavy chain in association with a heterodimeric surrogate light chain. IGLL1 is one of the surrogate light chain subunits and is a member of the immunoglobulin gene superfamily. Mutations in its gene can result in B cell deficiency and agammaglobulinemia, an autosomal recessive disease in which few or no gamma globulins or antibodies are made.The preB cell receptor is found on the surface of proB and preB cells, where it is involved in transduction of signals for cellular proliferation, differentiation from the proB cell to the preB cell stage, allelic exclusion at the Ig heavy chain gene locus, and promotion of Ig light chain gene rearrangements. The preB cell receptor is composed of a membrane-bound Ig mu heavy chain in association with a heterodimeric surrogate light chain. This gene encodes one of the surrogate light chain subunits and is a member of the immunoglobulin gene superfamily. This gene does not undergo rearrangement. Mutations in this gene can result in B cell deficiency and agammaglobulinemia, an autosomal recessive disease in which few or no gamma globulins or antibodies are made. Two transcript variants encoding different isoforms have been found for this gene.

MYOC; IGLL1

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

IGLL1 is supported by BioGPS gene expression data to be expressed in Jurkat

0.5 mg/ml

Human: 100%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

19kDa

Bourne, P.C., Acta Crystallogr. D Biol. Crystallogr. 58 (PT 5), 815-823 (2002)

Wet Ice

213

IGLL1

IGLL1

Rabbit

Immunoglobulin lambda-like polypeptide 1

NM_020070

RSRWGRFLLQRGSWTGPRCWPRGFQSKHNSVTHVFGSGTQLTVLSQPKAT