IL 23 Zijn recombinant eiwit

Source : HEK 293 cells. IL-23 Human Recombinant produced in HEK 293 cells is a heterodimer (IL23A co-transfected with IL12B), containing one polypeptide chain of IL23 protein (19.77kDa) fused with a C-terminal His tag and one polypeptide chain of IL12b-Flag (35.69kDa) .The IL-23 is purified by proprietary chromatographic techniques. IL23 is composed of a subunit of the heterodimeric cytokine IL23 and the p40 subunit of interleukin 12 (IL12B) . Interleukin-23 (IL-23) belongs to the IL-12 family and is produced by antigen presenting cells. IL-23 using IL12RB1 and IL-23R (specific for IL-23) can activate STAT and NF-kB pathways and stimulate the production of interferon-gamma.) . IL-23 is known to take a vital part in the inflammation process and is associated with auto immune diseases. However, unlike IL12, which acts primarily on naive CD4 (+) T cells, IL23 preferentially acts on memory CD4 (+) T cells.

Interleukin 23 alpha subunit p19||Interleukin-12 subunit beta p40||SGRF||IL23P19||IL-23-A||interleukin-six||G-CSF related factor||JKA3 induced upon T-cell activation||interleukin 12B (natural killer cell stimulatory factor 2 cytotoxic lymphocyte matu

Greater than 90.0% as determined by analysis by SDS-PAGE.

IL-23 His Tag protein is supplied in 50mM Tris pH 7.5, 130mM NaCl and 10% Glycerol.

Store at 4°C if entire vial will be used within 2-4 weeks.Store, frozen at -20°C for longer periods of time.Please avoid freeze thaw cycles.

IL23A-His:RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCG DGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLS QLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP HHHHHHHH. IL12B-Flag:IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVK EFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYS GRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVEC QEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQV EVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVR AQDRYYSSSWSEWASVPCSDYKDDDDK.