Jundm2 Antilichaam - C-terminalgebied: HRP (ARP37414 P050-HRP)

Jun dimerization protein 2

TI, TIF, Jundm, Jundm2, Jundp2

81703

P97875

NP_112149

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse

The immunogen is a synthetic peptide directed towards the c terminal region of mouse Jundm2

Jundm2 is a component of the AP-1 transcription factor that represses transactivation mediated by the Jun family of proteins. Jundm2 is involved in a variety of transcriptional responses associated with AP-1, such as UV-induced apoptosis, cell differentiation, tumorigenesis and antitumogeneris.Jundm2 can also function as a repressor by recruiting histone deacetylase 3/HDAC3 to the promoter region of JUN.Jundm2 may control transcription via direct regulation of the modification of histones and the assembly of chromatin.

Atf2; Hdac1; Hdac3; Hdac2; Jdp2; Taf13; Pbx4; Polr2i; Meis3; Dlx5; Dbp; Cebpg; Cebpa; Alx3; Jun

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 93%; Mouse: 100%; Rat: 100%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

19kDa

Wet Ice

163

JDP2

Jdp2

Rabbit

Jun dimerization protein 2

NM_030887

LKTQIEELKLERQQLILMLNRHRPTCIVRTDSVRTPESEGNPLLEQLDKK