KLF12 Antilichaam - N-terminalgebied: HRP (ARP38927 P050-HRP)

Kruppel-like factor 12

AP2REP, AP-2rep, HSPC122

11278

Q9Y4X4

NP_009180

Human, Dog, Guinea Pig, Rabbit

The immunogen is a synthetic peptide directed towards the N terminal region of human KLF12

Activator protein-2 alpha (AP-2 alpha) is a developmentally-regulated transcription factor and important regulator of gene expression during vertebrate development and carcinogenesis. KLF12 is a member of the Kruppel-like zinc finger protein family and can repress expression of the AP-2 alpha gene by binding to a specific site in the AP-2 alpha gene promoter. Repression by the encoded protein requires binding with a corepressor, CtBP1.Activator protein-2 alpha (AP-2 alpha) is a developmentally-regulated transcription factor and important regulator of gene expression during vertebrate development and carcinogenesis. The protein encoded by this gene is a member of the Kruppel-like zinc finger protein family and can repress expression of the AP-2 alpha gene by binding to a specific site in the AP-2 alpha gene promoter. Repression by the encoded protein requires binding with a corepressor, CtBP1. Two transcript variants encoding different isoforms have been found for this gene.

THAP1; CTBP1; APP; EHMT2

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity Purified

KLF12 is strongly supported by BioGPS gene expression data to be expressed in 721_B

0.5 mg/ml

Dog: 100%; Guinea Pig: 93%; Human: 100%; Rabbit: 86%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

44kDa

Suda, S., (2006) Biochem. Biophys. Res. Commun. 344 (1), 246-252

Wet Ice

402

KLF12

KLF12

Rabbit

Krueppel-like factor 12

NM_007249

NIHMKRKTIKNINTFENRMLMLDGMPAVRVKTELLESEQGSPNVHNYPDM