Mafg Antilichaam - N-terminalgebied: FITC (ARP32010 P050-FITC)

AA545192, C630022N07Rik

17134

O54790

NP_034886

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Mafg

Since they lack a putative transactivation domain, the small Mafs behave as transcriptional repressors when they dimerize among themselves. However, they seem to serve as transcriptional activators by dimerizing with other (usually larger) basic-zipper proteins and recruiting them to specific DNA-binding sites. Small Maf proteins heterodimerize with Fos and may act as competitive repressors of the NF-E2 transcription factor. Transcription factor, component of erythroid-specific transcription factor NF-E2. Mafg activates globin gene expression when associated with NF-E2 and may be involved in signal transduction of extracellular H+.

Sumo2; Sumo3; Nfe2l2; Bach2; Bach1

FITC: Fluorescein Isothiocyanate

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

18kDa

Wet Ice

162

MAFG

Mafg

Rabbit

Transcription factor MafG

NM_010756

TPNKGNKALKVKREPGENGTSLTDEELVTMSVRELNQHLRGLSKEEIIQL