MPP7 Antilichaam - N-terminal regio : HRP (ARP53247 P050-HRP)

Membrane protein, palmitoylated 7 (MAGUK p55 subfamily member 7)

FLJ32798, RP11-218D6.5

143098

Q5T2T1

NP_775767

Human, Mouse, Rat, Cow, Dog, Horse, Rabbit

The immunogen is a synthetic peptide directed towards the N terminal region of human MPP7

MPP7 acts as an important adapter that promotes epithelial cell polarity and tight junction formation via its interaction with DLG1. MPP7 is involved in the assembly of protein complexes at sites of cell-cell contact.Membrane-associated guanylate kinases (MAGUKs) are important adaptor proteins involved in the assembly of protein complexes at sites of cell-cell contact. They are found in synapses, adherens junctions, and tight junctions. All MAGUKs contain at least 1 PDZ domain, an SH3 domain, and a GUK domain, and many contain 1 or 2 L27 domains, which are involved in multimerization of MAGUKs. MPP7 belongs to the p55 stardust subfamily of MAGUKs, which is named for a Drosophila gene required for establishment of cell polarity in the developing fly embryo (Bohl et al., 2007 [PubMed 17237226]) .[supplied by OMIM].

AMOT; Wwtr1; Yap1; UBC

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 100%; Dog: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

65kDa

Stucke, V.M., (2007) Mol. Biol. Cell 18 (5), 1744-1755

Wet Ice

576

MPP7

MPP7

Rabbit

MAGUK p55 subfamily member 7

NM_173496

MPALSTGSGSDTGLYELLAALPAQLQPHVDSQEDLTFLWDMFGEKSLHSL