NEK7 Antilichaam - N-terminalgebied: HRP (ARP48999_P050-HRP)

NIMA (never in mitosis gene a) -related kinase 7

140609

Q8TDX7

NP_598001

Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep, Yeast, Zebrafish

The immunogen is a synthetic peptide directed towards the N terminal region of human NEK7

NIMA-related kinases share high amino acid sequence identity with the gene product of the Aspergillus nidulans 'never in mitosis A' gene, which controls initiation of mitosis.NIMA-related kinases share high amino acid sequence identity with the gene product of the Aspergillus nidulans 'never in mitosis A' gene, which controls initiation of mitosis.[supplied by OMIM].

UBC; tat; NEK9; NEK6

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 100%; Dog: 100%; Goat: 79%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Sheep: 79%; Yeast: 92%; Zebrafish: 100%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

34kDa

Kim, S., (2007) Biochem. Biophys. Res. Commun. 360 (1), 56-62

Wet Ice

302

NEK7

NEK7

Rabbit

Serine/threonine-protein kinase Nek7

NM_133494

KARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMI