Nkx2-5 Antilichaam - N-terminalgebied: HRP (ARP36946_P050-HRP)

NK2 transcription factor related, locus 5 (Drosophila)

Cs, ti, Csx, Nkx2., Nkx-2., Nkx2.5, tinman, Nkx-2.5

18091

P42582

NP_032726

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit

The immunogen is a synthetic peptide directed towards the n terminal region of mouse Nkx2-5

Homeobox-containing genes play critical roles in regulating tissue-specific gene expression essential for tissue differentiation, as well as determining the temporal and spatial patterns of development. It has been demonstrated that a Drosophila homeobox-containing gene called 'tinman' is expressed in the developing dorsal vessel and in the equivalent of the vertebrate heart. Mutations in tinman result in loss of heart formation in the embryo, suggesting that tinman is essential for Drosophila heart formation. Furthermore, abundant expression of Csx, the presumptive mouse homolog of tinman, is observed only in the heart from the time of cardiac differentiation. CSX, the human homolog of murine Csx, has a homeodomain sequence identical to that of Csx and is expressed only in the heart, again suggesting that CSX plays an important role in human heart formation.

Tbx5; Foxh1; Hand2; Hand1; Mef2c; Tbx1; Prox1; Smarca4; SRF

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 86%; Dog: 86%; Guinea Pig: 86%; Human: 80%; Mouse: 100%; Rabbit: 86%; Rat: 93%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

34kDa

Wet Ice

318

NKX2-5

Nkx2-5

Rabbit

Homeobox protein Nkx-2.5

NM_008700

MFPSPALTPTPFSVKDILNLEQQQRSLASGDLSARLEATLAPASCMLAAF