Nr0b1 Antilichaam - C-terminalgebied: HRP (ARP32871 P050-HRP)

AH, AHX, Ahc, Dax, Ahch, DAX-, Dax1, DAX-1

11614

Q61066

NP_031456

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Nr0b1

Nr0b1 is an orphan nuclear receptor and a component of a cascade required for the development of the hypothalamic-pituitary-adrenal-gonadal axis. Nr0b1 acts as a coregulatory protein that inhibits the transcriptional activity of other nuclear receptors through heterodimeric interactions. Nr0b1 may also have a role in the development of the embryo and in the maintenance of embryonic stem cell pluripotency.

Nanog; Nr4a1; Zfp609; Wdr5; Ogt; Pelo; Sall4; Snw1; Rif1; Esrrb; Trim28; Sp1; Rest; Pou5f1; Prmt1; Hnf4a; Sall1; Nr5a1; Nr5a2

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 92%; Dog: 75%; Guinea Pig: 92%; Horse: 83%; Human: 100%; Mouse: 92%; Rabbit: 92%; Rat: 92%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

52kDa

Wet Ice

472

NR0B1

Nr0b1

Rabbit

Nuclear receptor subfamily 0 group B member 1

NM_007430

YIEGLQWRTQQILTEHIRMMQREYQIRSAELNSALFLLRFINSDVVTELF