PARP16 Antilichaam - N-terminalgebied: HRP (ARP33751_P050-HRP)

Poly (ADP-ribose) polymerase family, member 16

ARTD15, pART15, C15orf30

54956

Q6PK64

NP_060321

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit

The immunogen is a synthetic peptide directed towards the N terminal region of human PARP16

Poly (ADP-ribosyl) ation is an immediate DNA-damage-dependent post-translational modification of histones and other nuclear proteins that contributes to the survival of injured proliferating cells. PARP16 is a member of poly (ADP-ribose) polymerases (PARPs) family that is encoded by different genes and displaying a conserved catalytic domain in which PARP-1 (113 kDa), the founding member, and PARP-2 (62 kDa) are so far the sole enzymes whose catalytic activity has been shown to be immediately stimulated by DNA strand breaks. A large repertoire of sequences encoding novel PARPs now extends considerably the field of poly (ADP-ribosyl) ation reactions to various aspects of the cell biology including cell proliferation and cell death. Some of these new members interact with each other, share common partners and common subcellular localizations suggesting possible fine tuning in the regulation of this post-translational modification of proteins.

GMCL1; UBC; NEDD4

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB, IHC

Affinity Purified

0.5 mg/ml

Cow: 100%; Dog: 93%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

36kDa

Strausberg, R.L., et al., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903

Wet Ice

323

PARP16

PARP16

Rabbit

Mono [ADP-ribose] polymerase PARP16

NM_017851

KRDSVLRPFPASYARGDCKDFEALLADASKLPNLKELLQSSGDNHKRAWD