PFN1 Antilichaam - N-terminalgebied: FITC (ARP48269 P050-FITC)

Profilin 1

ALS18

5216

P07737

NP_005013

Human, Mouse, Rat, Cow, Guinea Pig, Horse, Zebrafish

The immunogen is a synthetic peptide directed towards the N terminal region of human PFN1

PFN1 is a ubiquitous actin monomer-binding protein belonging to the profilin family. It is thought to regulate actin polymerization in response to extracellular signals. Deletion of this gene is associated with Miller-Dieker syndrome.The protein encoded by this gene is a ubiquitous actin monomer-binding protein belonging to the profilin family. It is thought to regulate actin polymerization in response to extracellular signals. Deletion of this gene is associated with Miller-Dieker syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

UBC; FUS; STUB1; SUMO1; NEDD8; MDM2; ASB12; ASB2; ASB1; YWHAQ; SRPK1; ESR1; RAD52; RAD51; ACTB; VCAM1; ITGA4; FN1; ATF2; LIG4; SET; ACAA2; LOC440434; MRPL53; SRPRB; CAND1; CUL3; CDK2; ISG15; ELAVL1; AI837181; Akap12; Csnk1e; Mapk13; UCHL5; WIPF2; LRIF1; M

FITC: Fluorescein Isothiocyanate

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 91%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

15kDa

Wen, K.K., (2008) J. Biol. Chem. 283 (14), 9444-9453

Wet Ice

140

PFN1

PFN1

Rabbit

Profilin-1

NM_005022

AGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVL