Pias2 Antilichaam - N-terminal regio : HRP (ARP53839_P050-HRP)

Protein inhibitor of activated STAT 2

Di, PI, DIP, Dib, Miz, Miz1, PIAS, SIZ2, ARIP3, PIASxb, AI462206, AU018068, PIASxbeta, PIASxalpha, PIASxalpha6

17344

Q8C5D8-4

NP_001157639

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish

Pias2 functions as an E3-type small ubiquitin-like modifier (SUMO) ligase, stabilizing the interaction between UBE2I and the substrate, and as a SUMO-tethering factor.Pias2 plays a crucial role as a transcriptional coregulation in various cellular pathways, including the STAT pathway, the p53 pathway and the steroid hormone signaling pathway. The effects of this transcriptional coregulation, transactivation or silencing may vary depending upon the biological context and PIAS2 isoform studied. However, it seems to be mostly involved in gene silencing.Pias2 binds to sumoylated ELK1 and enhances its transcriptional activity by preventing recruitment of HDAC2 by ELK1, thus reversing SUMO-mediated repression of ELK1 transactivation activity. Isoform PIASx-beta, but not isoform PIASx-alpha, promotes MDM2 sumoylation. Isoform PIASx-alpha promotes PARK7 sumoylation. Isoform PIASx-beta promotes NCOA2 sumoylation more efficiently than isoform PIASx-alpha

Pparg; Egr2; Plagl2; Trim32; Trp53; DHX9; Nfkb1; Gtf2i; GTF2IRD1; HDAC3

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 83%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

63kDa

Wet Ice

580

PIAS2

Pias2

Rabbit

E3 SUMO-protein ligase PIAS2

NM_001164167

PAVQIKIRELYRRRYPRTLEGLCDLSTIKSSVFSLDGSSSPVEPDLPVAG