Recombinant Runder Rhodopsin (RHO) , gedeeltelijk

RHO; Rhodopsin

Recombinant Bovine RHO protein, partial

RHO

P02699

1-36aa

Bos taurus (Bovine)

MNGTEGPNFYVPFSNKTGVVRSPFEAPQYYLAEPWQ

N-terminal 6xHis-KSI-tagged

In Stock Protein

E.coli

Signal Transduction

Photoreceptor required for image-forming vision at low light intensity. Required for photoreceptor cell viability after birth (By similarity) . Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change that activates signaling via G-proteins.

Not test

Greater than 85% as determined by SDS-PAGE.

Not Test

Liquid or Lyophilized powder

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

19.5 kDa

"Rhodopsin and bacteriorhodopsin: structure-function relationships." Ovchinnikov Y.A. FEBS Lett. 148:179-191 (1982)

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

https://www.cusabio.com/msds/12928372/

Partial