Recombinant humaan beta-defensin 1/DEFB1

Source: E.coli. MW :5.07kD. Recombinant Human beta-Defensin 1 is produced by our E.coli expression system and the target gene encoding Gly22-Lys68 is expressed. beta-Defensin 1 (DEFB1) is a member of the beta-defensin family, which is highly expressed by epithelial cells. beta-defensins are expressed as the C-terminal portion of precursors and are released by proteolytic cleavage of a signal peptide. beta-defensins contain a six-cysteine motif that forms three intra-molecular disulfide bonds. beta-defensin 1 is an antimicrobial peptide implicated in the resistance of epithelial surfaces to microbial colonization. Defects in beta-Defensin-1 contribute to asthma diagnosis, with apparent gender-specific effects in human. beta-defensin 1 may also play a role in the pathogenesis of severe sepsis. In addition, beta-defensin 1 is associated with induction profiles in gingival keratinocytes.

DEFB1

1672

P60022

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 130mM NaCl, pH 7.4.

The product is shipped at ambient temperature.

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

GNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK