Recombinant humaan interferon a-6/IFNA6 (C-6His)

Source: Human Cells. MW :21.1kD. Recombinant Human Interferon alpha-6 is produced by our Mammalian expression system and the target gene encoding Ser21-Glu189 is expressed with a 6His tag at the C-terminus. Interferon a-6 (IFN-a6) is a secreted protein which belongs to the a/ beta interferon family. IFN-a6 is produced by macrophages, expressed at low level, only 1.0% of the average gene in this release. IFN-a6 contains interferon alpha, beta and delta domain. IFN-a has antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.

IFNA6

3443

P05013

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

The product is shipped at ambient temperature.

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

SLDCDLPQTHSLGHRRTMMLLAQMRRISLFSCLKDRHDFRFPQEEFDGNQFQKAEAISVLHEVIQQTFNLFSTKDSSVAWDERLLDKLYTELYQQLNDLEACVMQEVWVGGTPLMNEDSILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSSSRNLQERLRRKEVDHHHHHH