Recombinant humaan interleukine-1a/IL-1a
Gecertificeerd

Recombinant humaan interleukine-1a/IL-1a

Catalog #: 32-7059-10
Maat: 10 µg

Kwaliteit

ISO Gecertificeerd

Levering

24-48 uur

Prijs -1%
Login voor prijs
BTW niet inbegrepen
Gratis verzending vanaf €100
Technische Documentatie

Technische Specificaties

Description

Source: E.coli. MW :18kD. Recombinant Human Interleukin-1 alpha is produced by our E.coli expression system and the target gene encoding Ser113-Ala271 is expressed. Interleukin-1 alpha (IL1a) is a cytokine member of the interleukin-1 family. IL-1 consists of two distinct forms: IL1a and IL1 beta that recognize the same cell surface receptors but are distinct proteins with approximately 25% amino acid sequence identity. IL1a is constitutively produced by epithelial cells and plays an essential role in maintenance of skin barrier function. Upon stimulation, a wide variety of cells including osteoblasts, monocytes, macrophages can be induced to express IL1a. IL1a possesses a wide range of metabolic, physiological, haematopoietic activities, and is critically involved in the regulation of the immune responses and inflammatory responses.

Gene Name

IL1A

Gene ID

3552

UniProt

P01583

Components

Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, pH 7.5.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA

Beschrijving

Source: E.coli. MW :18kD. Recombinant Human Interleukin-1 alpha is produced by our E.coli expression system and the target gene encoding Ser113-Ala271 is expres

Specificaties

ProductnaamRecombinant humaan interleukine-1a/IL-1a
Categorie
Beschikbare grootte10 µg
Catalogusnummer32-7059-10