Recombinant humaan parvalbumine a/PVALB (C-6His)
Gecertificeerd

Recombinant humaan parvalbumine a/PVALB (C-6His)

Catalog #: 32-7136-10
Maat: 10 µg

Kwaliteit

ISO Gecertificeerd

Levering

24-48 uur

Prijs -1%
Login voor prijs
BTW niet inbegrepen
Gratis verzending vanaf €100
Technische Documentatie

Technische Specificaties

Description

Source: E.coli. MW :13.12kD. Recombinant Human Parvalbumin alpha is produced by our E.coli expression system and the target gene encoding Ser2-Ser110 is expressed with a 6His tag at the C-terminus. Parvalbumin a (PVALB) is a member of the parvalbumin family. PVALB is a high affinity calcium ion-binding protein, with two EF hand domains. PVALB is structurally and functionally similar to calmodulin and troponin C, it can bind two calcium ions. Parvalbumin is thought to be involved in relaxation after contraction in muscle. Parvalbumin is expressed in a specific population of GABAergic interneurons, which are believed to have a role in maintaining the balance between excitation and inhibition in the cortex as well as the hippocampus.

Gene Name

PVALB

Gene ID

5816

UniProt

P20472

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

SMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAESLEHHHHHH

Beschrijving

Source: E.coli. MW :13.12kD. Recombinant Human Parvalbumin alpha is produced by our E.coli expression system and the target gene encoding Ser2-Ser110 is express

Specificaties

ProductnaamRecombinant humaan parvalbumine a/PVALB (C-6His)
Categorie
Beschikbare grootte10 µg
Catalogusnummer32-7136-10