Recombinant humaan repressoreiwit YY1 (C-6His)
Gecertificeerd

Recombinant humaan repressoreiwit YY1 (C-6His)

Catalog #: 32-8344-10
Maat: 10 µg

Kwaliteit

ISO Gecertificeerd

Levering

24-48 uur

Prijs -1%
Login voor prijs
BTW niet inbegrepen
Gratis verzending vanaf €100
Technische Documentatie

Technische Specificaties

Description

Source: E. coli. MW :12.6kD. Recombinant Human Yin and Yang 1 protein is produced by our E.coli expression system and the target gene encoding Val221-Gly321 is expressed with a 6His tag at the C-terminus. Transcriptional repressor protein YY1 (YY1) contains 4 C2H2-type zinc fingers and belongs to the YY transcription factor family. Multifunctional transcription factor exhibits positive and negative control on a large number of cellular and viral genes by binding to sites overlapping the transcription start site. The effect on transcription regulation of the protein is depending upon the context in which it binds and diverse mechanisms of action include direct activation or repression, indirect activation or repression via cofactor recruitment, or activation or repression by disruption of binding sites or conformational DNA changes. Its activity is regulated by transcription factors and cytoplasmic proteins that have been shown to abrogate or completely inhibit YY1-mediated activation or repression.

Gene Name

YY1

Gene ID

7528

UniProt

P25490

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MVTMWSSDEKKDIDHETVVEEQIIGENSPPDYSEYMTGKKLPPGGIPGIDLSDPKQLAEFARMKPRKIKEDDAPRTIACPHKGCTKMFRDNSAMRKHLHTHGLEHHHHHH

Beschrijving

Source: E. coli. MW :12.6kD. Recombinant Human Yin and Yang 1 protein is produced by our E.coli expression system and the target gene encoding Val221-Gly321 is

Specificaties

ProductnaamRecombinant humaan repressoreiwit YY1 (C-6His)
Categorie
Beschikbare grootte10 µg
Catalogusnummer32-8344-10