Recombinant Human Fibroblast Growth Factor 12/FGF-12
Gecertificeerd

Recombinant Human Fibroblast Growth Factor 12/FGF-12

Catalog #: 32-7200-10
Maat: 10 µg

Kwaliteit

ISO Gecertificeerd

Levering

24-48 uur

Prijs -1%
Login voor prijs
BTW niet inbegrepen
Gratis verzending vanaf €100
Technische Documentatie

Technische Specificaties

Description

Source: E.coli. MW :20.45kD. Recombinant Human Fibroblast Growth Factor 12 is produced by our E.coli expression system and the target gene encoding Met1-Thr181 is expressed. Fibroblast Growth Factor 12 (FGF-12) is a member of the fibroblast growth factor (FGF) family. FGF-12 is probably involved in nervous system development and function. FGF-12 lacks the N-terminal signal sequence present in most of the FGF family members, but it contains clusters of basic residues that have been demonstrated to act as a nuclear localization signal. When transfectedinto mammalian cells, this protein accumulated in the nucleus, but was not secreted. The specific function of this gene has not yet been determined. Two alternatively spliced transcript variants encoding distinct isoforms have been reported.

Gene Name

FGF12

Gene ID

2257

UniProt

P61328

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 5mM EDTA, pH 7.5.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREQSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST

Beschrijving

Source: E.coli. MW :20.45kD. Recombinant Human Fibroblast Growth Factor 12 is produced by our E.coli expression system and the target gene encoding Met1-Thr181

Specificaties

ProductnaamRecombinant Human Fibroblast Growth Factor 12/FGF-12
Categorie
Beschikbare grootte10 µg
Catalogusnummer32-7200-10