Recombinant Human U6 snRNA-geassocieerde Sm-Like Protein LSm4/LSM4 (N-6His)

Source: E.coli. MW :17.5kD. Recombinant Human LSM4 is produced by our E.coli expression system and the target gene encoding Met1-Gln139 is expressed with a 6His tag at the N-terminus. U6 snRNA-associated Sm-like protein LSm4 (LSM4) is a member of the snRNP Sm proteins family. Sm-like proteins contain the Sm sequence motif and are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing. LSM4 forms a heteromer with a donut shape. The complexes are involved in various steps of RNA metabolism. LSM4 binds specifically to the 3-terminal U-tract of U6 snRNA. LSM4 contributes RNA protein interactions and structural changes which are essential during ribosomal subunit assembly.

LSM4

25804

Q9Y4Z0

Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 100mM NaCl, 1mM DTT, pH 8.0 .

The product is shipped at ambient temperature.

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

MGSSHHHHHHSSGLVPRGSHMLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPDEIIDMVKEEVVAKGRGRGGLQQQKQQKGRGMGGAGRGVFGGRGRGGIPGTGRGQPEKKPGRQAGKQ