Recombinant Mouse Interferon gamma/IFN-gamma (C-6His)
Gecertificeerd

Recombinant Mouse Interferon gamma/IFN-gamma (C-6His)

Catalog #: 32-8708-10
Maat: 10 µg
Droogijs Vereist

Kwaliteit

ISO Gecertificeerd

Levering

24-48 uur

Prijs -1%
Login voor prijs
BTW niet inbegrepen
Gratis verzending vanaf €100
Technische Documentatie

Technische Specificaties

Description

Source: Human Cells. MW :16.6kD. Recombinant Mouse Interferon gamma is produced by our Mammalian expression system and the target gene encoding His23-Cys155 is expressed with a 6His tag at the C-terminus. Mouse Ifng is a secreted protein which belongs to the type I I (or gamma) interferon family. IFNG is produced by lymphocytes and activated by specific antigens or mitogens. In addition to having antiviral activity, IFNG also has important immunoregulatory functions. It is a potent activator of macrophages and has antiproliferative effects on transformed cells. It can potentiate the antiviral and antitumor effects of the type I interferons. Genetic variation in IFNG is associated with the risk of aplastic anemia (AA) which is a rare disease in which the reduction of the circulating blood cells results from damage to the stem cell pool in bone marrow. In most patients, the stem cell lesion is caused by an autoimmune attack. T-lymphocytes, activated by an endogenous or exogenous, and most often unknown antigenic stimulus, secrete cytokines, including IFN-gamma, which would in turn be able to suppress hematopoiesis.

Gene Name

Ifng

Gene ID

15978

UniProt

P01580

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

HGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRCVDHHHHHH

Beschrijving

Source: Human Cells. MW :16.6kD. Recombinant Mouse Interferon gamma is produced by our Mammalian expression system and the target gene encoding His23-Cys155 is

Specificaties

ProductnaamRecombinant Mouse Interferon gamma/IFN-gamma (C-6His)
Categorie
Beschikbare grootte10 µg
Catalogusnummer32-8708-10