Recombinant Mouse Interleukin-4/IL-4
Gecertificeerd

Recombinant Mouse Interleukin-4/IL-4

Catalog #: 32-8585-50
Maat: 50 µg

Kwaliteit

ISO Gecertificeerd

Levering

24-48 uur

Prijs -1%
Login voor prijs
BTW niet inbegrepen
Gratis verzending vanaf €100
Technische Documentatie

Technische Specificaties

Description

Source: E.coli. MW :13.4kD. Recombinant Mouse Interleukin-4 is produced by our E.coli expression system and the target gene encoding His23-Ser140 is expressed. Mouse Interleukin-4 (IL-4) is a monomeric, Th2 cytokine that shows pleiotropic effects during immune responses. It is a glycosylated polypeptide that contains three intrachain disulfide bridges and adopts a bundled four a­helix structure. IL­4 exerts its effects through two receptor complexes, Participates in at least several B-cell activation processes as well as of other cell types. IL­4 is primarily expressed by Th2­biased CD4+T cells, mast cells, basophils, and eosinophils. It promotes cell proliferation, survival, and immunoglobulin class switch to IgG1 and IgE in mouse B cells, acquisition of the Th2 phenotype by naà ̄ve CD4+T cells, priming and chemotaxis of mast cells, eosinophils, and basophils, and the proliferation and activation of epithelial cells. IL­4 plays a dominant role in the development of allergic inflammation and asthma. It also regulates the expression of the low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes.

Gene Name

Il4

Gene ID

16189

UniProt

P07750

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS

Beschrijving

Source: E.coli. MW :13.4kD. Recombinant Mouse Interleukin-4 is produced by our E.coli expression system and the target gene encoding His23-Ser140 is expressed.

Specificaties

ProductnaamRecombinant Mouse Interleukin-4/IL-4
Categorie
Beschikbare grootte50 µg
Catalogusnummer32-8585-50