Recombinante Mouse Leukemie-remmerfactor/lIF
Gecertificeerd

Recombinante Mouse Leukemie-remmerfactor/lIF

Catalog #: 32-7589-10
Maat: 10 µg

Kwaliteit

ISO Gecertificeerd

Levering

24-48 uur

Prijs -1%
Login voor prijs
BTW niet inbegrepen
Gratis verzending vanaf €100
Technische Documentatie

Technische Specificaties

Description

Source: E.coli. MW :19.9kD. Recombinant Mouse Leukemia Inhibitory Factor is produced by our E.coli expression system and the target gene encoding Ser24-Phe203 is expressed. Mouse Leukemia inhibitory factor (lif) is a secreted protein which belongs to the LIF/OSM family.LIF has been implicated in a many physiological processes including development, hematopoiesis, bone metabolism, and inflammation. it has the capacity to induce terminal differentiation in leukemic cells. Its activities include the induction of hematopoietic differentiation in normal and myeloid leukemia cells, the induction of neuronal cell differentiation, and the stimulation of acute-phase protein synthesis in hepatocytes.

Gene Name

Lif

Gene ID

16878

UniProt

P09056

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

SPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAF

Beschrijving

Source: E.coli. MW :19.9kD. Recombinant Mouse Leukemia Inhibitory Factor is produced by our E.coli expression system and the target gene encoding Ser24-Phe203 i

Specificaties

ProductnaamRecombinante Mouse Leukemie-remmerfactor/lIF
Categorie
Beschikbare grootte10 µg
Catalogusnummer32-7589-10