RNF128 Antilichaam - C-terminalgebied: HRP (ARP59127 P050-HRP)

Ring finger protein 128, E3 ubiquitin protein ligase

GRAIL

79589

Q8TEB7-2

NP_078815

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit

The immunogen is a synthetic peptide directed towards the C terminal region of human RNF128

RNF128 is a type I transmembrane protein that localizes to the endocytic pathway. This protein contains a RING zinc-finger motif and has been shown to possess E3 ubiquitin ligase activity. Expression of RNF128 in retrovirally transduced T cell hybridoma significantly inhibits activation-induced IL2 and IL4 cytokine production. Induced expression of RNF128 was observed in anergic CD4 (+) T cells, which suggested a role in the induction of anergic phenotype.

CEP76; APPBP2; TP53; UBE2H; UBE2E1; UBE2D1; Arhgdia; Arhgdib; RNF128; UBE2T; UBE2I; UBE2N; CD40LG; OTUB1; USP8

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity Purified

RNF128 is supported by BioGPS gene expression data to be expressed in COLO205

0.5 mg/ml

Cow: 92%; Dog: 100%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Mouse: 85%; Pig: 93%; Rabbit: 93%; Rat: 92%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

44kDa

Wet Ice

402

RNF128

RNF128

Rabbit

E3 ubiquitin-protein ligase RNF128

NM_024539

PMCKCDILKALGIEVDVEDGSVSLQVPVSNEISNSASSHEEDNRSETASS