Rnf216 Antilichaam - N-terminalgebied : FITC (ARP57824 P050-FITC)

Ring finger protein 216

UIP, UIP83, C86502, TRIAD3, Ubce7i, AI647468, AU019462, Ubce7ip1, 2810055G22Rik, F830018F18Rik

108086

P58283

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit

The immunogen is a synthetic peptide directed towards the N-terminal region of MOUSE Rnf216

Rnf216 acts as an E3 ubiquitin ligase, which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes, and then transfers it to substrates promoting their degradation by the proteasome. It promotes degradation of TRAF3, TLR4 and TLR9. It contributes to the regulation of antiviral responses. It down-regulates activation of NF-kappa-B, IRF3 activation and IFNB production and promotes TNF and RIP mediated apoptosis.

Ube2l3

FITC: Fluorescein Isothiocyanate

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 86%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 93%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

93kDa

Wet Ice

853

RNF216

Rnf216

Rabbit

E3 ubiquitin-protein ligase RNF216

IVNPRLEQKVIILGENGLLFPESEPLEVQNQSSEDSETELLSNPGEPAAS