SH3KBP1 Antilichaam - N-terminalgebied: HRP (ARP54453 P050-HRP)

SH3-domain kinase binding protein 1

HSB1, AGMX2, CIN85, GIG10, HSB-1, IMD61, MIG18, CD2BP3

30011

Q5JPT5

NP_001019837

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish

The immunogen is a synthetic peptide directed towards the N terminal region of human SH3KBP1

This gene encodes an adapter protein that contains three N-terminal Src homology domains, a proline rich region and a C-terminal coiled-coil domain. The encoded protein facilitates protein-protein interactions and has been implicated in numerous cellular processes including apoptosis, cytoskeletal rearrangement, cell adhesion and in the regulation of clathrin-dependent endocytosis. Alternate splicing results in multiple transcript variants.

PNMA5; ZBTB7B; SH3KBP1; STAP1; FRS3; SPRY2; ASAP2; PSMA3; CBL; UBC; RAF1; LOX; INPP5D; Dlg4; FAP; ARHGAP17; Ap2a1; Irf2bp1; Gcdh; Sept7; Wipf1; Chtf8; Cblb; Shkbp1; Rtkn2; Idh3b; Pik3ap1; Slc25a12; Wasl; Ap2b1; Arap1; Far1; Cltc; Timm50; Actn4; Sept6; Net

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB, IHC

Affinity Purified

0.5 mg/ml

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

68

Wet Ice

628

SH3KBP1

SH3KBP1

Rabbit

SH3 domain-containing kinase-binding protein 1

NM_001024666

TGMFPSNFIKELSGESDELGISQDEQLSKSSLRETTGSESDGGDSSSTKS