SLC39A7 Antilichaam - N-terminalgebied: HRP (ARP43812_P050-HRP)

Solute carrier family 39 (zinc transporter), member 7

KE4, HKE4, ZIP7, RING5, H2-KE4, D6S115E, D6S2244E

7922

Q92504

NP_001070984

Human, Cow, Dog, Horse, Pig, Rabbit, Sheep

The immunogen is a synthetic peptide directed towards the N terminal region of human SLC39A7

Zinc is an essential cofactor for more than 50 classes of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. Zinc cannot passively diffuse across cell membranes and requires specific transporters, such as SLC39A7, to enter the cytosol from both the extracellular environment and from intracellular storage compartments.Zinc is an essential cofactor for more than 50 classes of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. Zinc cannot passively diffuse across cell membranes and requires specific transporters, such as SLC39A7, to enter the cytosol from both the extracellular environment and from intracellular storage compartments.[supplied by OMIM].

UBC; SUZ12; BMI1; YY1; SUMO1; USP49; RGS20; CD40

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 86%; Dog: 100%; Horse: 100%; Human: 100%; Pig: 100%; Rabbit: 100%; Sheep: 86%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

50kDa

Ewing, R.M., Mol. Syst. Biol. 3, 89 (2007)

Wet Ice

469

SLC39A7

SLC39A7

Rabbit

Zinc transporter SLC39A7

NM_001077516

HDHEHSHGGYGESGAPGIKQDLDAVTLWAYALGATVLISAAPFFVLFLIP